PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.1153s0005.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 349aa    MW: 38058 Da    PI: 7.2023
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.1153s0005.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.83.3e-31188245259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +Dgy+WrKYGqK vk+s++prsYYrCt ++C+vkk+vers edp++v++tYeg+H h+
  Kalax.1153s0005.1.p 188 EDGYRWRKYGQKAVKNSPYPRSYYRCTNTKCTVKKRVERSCEDPTTVITTYEGQHCHQ 245
                          8*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-32172245IPR003657WRKY domain
SuperFamilySSF1182901.57E-27179246IPR003657WRKY domain
PROSITE profilePS5081129.907182247IPR003657WRKY domain
SMARTSM007748.6E-36187246IPR003657WRKY domain
PfamPF031066.3E-24188245IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MDGAREVPER SEPLEYDSLE YDSESRYLFD DMSTTECSIL SEFGWETTSS NLHLHRHRHH  60
HHHQPIDDPF IDFATSSISK SESIGSVRGG GGGSGLPRFA ETPPVTVAAE GNTSCGASKL  120
VEQASTSNPS VSSSSSDQDL AAEKSIGSGE TSPSSLQIPS GKSKKKGQPR IRQPRFAFVT  180
KSEVDHLEDG YRWRKYGQKA VKNSPYPRSY YRCTNTKCTV KKRVERSCED PTTVITTYEG  240
QHCHQIAGFP RGGALSIRGA AFGGQMGPPN SQYYYPGMQH VPHRSPNSSA APTPIPTSVT  300
DNEPKEASRM MILSTEPQLP QPASTPQVPS DEGLLGDIVS PRRRNLHP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-261802461076Probable WRKY transcription factor 4
2lex_A8e-261802461076Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9C9831e-61WRK57_ARATH; Probable WRKY transcription factor 57
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.23e-60WRKY DNA-binding protein 57